Хypothetical protein WP_003477458 459bp pUC vector - 100ug plasmid + 200ul glycerol

https://www.gentaur.be/web/image/product.template/5440/image_1920?unique=8f28d63

1958,80 zł 1958.8 PLN 1958,80 zł

415,00 €

Not Available For Sale

    Ta kombinacja nie istnieje.

    Terms and Conditions
    Gwarantowany zwrot pieniędzy przez 30dni
    Wysyłka w ciągu 2-3 dni roboczych

    DNA Sequence:

    RC48GOI: atgagtccatattatagatataaaaaagaaaaatttttagaaaagtatcaatcagcaactgataacttagaagatttaaaagtagcaataaaagaatataaagatactaataatagaattataagaagagctatgtttgctttctttcaagatttcactgaatatattattgatatgtgtgaaagttatatattgataaatgatgggaaaataaagagtacaacttctgcaacacagctagttgaacaagcatatgatatgggcttttttgataatgaactaaaaaaatacttagttttatcagtgaaacttagaaatagatatactcatgattattacctaagagaagagagcgaaaaagcaatagaagaattctgttttttaaaactagcaaatctagaaatatttttagaagaaagtaaggataaagttattcttaaatataaaaatttagtttaaMSPYYRYKKE

    Protein sequence:

    KFLEKYQSATDNLEDLKVAIKEYKDTNNRIIRRAMFAFFQDFTEYIIDMC
    ESYILINDGKIKSTTSATQLVEQAYDMGFFDNELKKYLVLSVKLRNRYTHDYYLREESEKAIEEFCFLKLANLEIFLEESKDKVILKYKNLV