Recombinant Human Growth/differentiation factor 9 (GDF9), Expression: E.coli, Tag: N-terminal GST, 20 ug

https://www.gentaur.be/web/image/product.template/5784/image_1920?unique=2a20a7d
(0 przegląd)

0,00 zł 0.0 PLN 0,00 zł netto

368,00 € netto

poland@gentaur.com

    Ta kombinacja nie istnieje.

    Warunki i postanowienia
    Gwarantowany zwrot pieniędzy przez 30dni
    Wysyłka w ciągu 2-3 dni roboczych

    Purity: Greater than 90% as determined by SDS-PAGE.

    Target Names: GDF9

    Uniprot No: O60383

    Research Area: Cardiovascular

    Alternative Names: GDF9Growth/differentiation factor 9; GDF-9

    Species: Homo sapiens (Human)

    Expression system: E.coli

    Expression Region: 320-454aa

    Protein Sequence: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

    Mol. Weight: 42.5kDa
    Protein Length: Full Length of Mature Protein
    Tag Info: N-terminal GST-tagged


    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel: