Recombinant SARS-CoV-2 Pirola variant Spike glycoprotein (S), partial, E.coli expression, tag-free - 1 mg

https://www.gentaur.be/web/image/product.template/8181/image_1920?unique=355a290

8713,12 zł 8713.12 PLN 8713,12 zł

1846,00 €

Not Available For Sale

    Ta kombinacja nie istnieje.

    Terms and Conditions
    Gwarantowany zwrot pieniędzy przez 30dni
    Wysyłka w ciągu 2-3 dni roboczych

    Type: Recombinant protein

    Expression system: E. coli

    Species: SARS-CoV-2, Pirola variant

    Tag: None

    Expression Region: 315-535 aa

    Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK