gene-30526.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9549/image_1920?unique=6809a1a

7429,28 zł 7429.28 PLN 7429,28 zł

1574,00 €

Not Available For Sale

    Ta kombinacja nie istnieje.

    Terms and Conditions
    Gwarantowany zwrot pieniędzy przez 30dni
    Wysyłka w ciągu 2-3 dni roboczych

    Expression System: E. coli

    Expression Region: Expression Region: 1-202aa;Full Length

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    METAGTTPPSKRRLTSKTSSFRLRCDSLNTLRLRR

    IFDLFDKNNDGFITVDELSSALNLLGLETDRSELE

    FTIISFIQPGNKGLRFEDFISLHQSLDETYFVCDDH

    IVNHVGAEEDQKMNNHQTMSQEDSDLSEAFK

    VFDEDGDGYISAKELQIVLGKLGFSEGNEIGRVEK

    MIFSVDRNQDGRVDFFEFKDMMRGVLVRSS