gene-38586.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9556/image_1920?unique=7fbefa3

9699,60 zł 9699.6 PLN 9699,60 zł

2055,00 €

Not Available For Sale

    Ta kombinacja nie istnieje.

    Terms and Conditions
    Gwarantowany zwrot pieniędzy przez 30dni
    Wysyłka w ciągu 2-3 dni roboczych

    Expression System: E. coli

    Expression Region: Expression Region: 25-407aa;Full Length of mature protein (The 1-24aa is the signal peptide, it usually is removed during the protein expression process.)

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    ESTLRRGLVGAAGLTDFNVNSYGAKADGKTDN

    VEAFMKAWVAACKSGGGPARLVFPKGTYVTGPL

    VFAGPCKASKITVEVQGTIKATTDISEYTSPEWILF

    ESISGLTLTGGIFDGRGETVWKYNDCDQNSDCQ

    LLPSSIKFSKLTNTVVHGITYLNSKSFHTHVNMC

    QNFKAYDLTITAPSNSPNTDGMHISSSNLVNVS

    NSVIGTGDDCISIGQGVTNLVVINITCGPGHGISV

    GSLGKYDDEKDVSGVVVSNCTLRNTANGVRIKT

    YSGSPPSKASGITFQDIIMDVVKNPIIIDQNYGSH

    KSAASKVQISGVHYKNIVGTATSDVAVSLLCSSQ

    VPCDVELVDIDLKFQGSSNKGKSASSSCLNAKV

    KTGGKLNPPACR