Recombinant Bovine Myoglobin (MB), Tag-free - 1 mg

https://www.gen.bg/web/image/product.template/10971/image_1920?unique=cc1561f
(0 przegląd)

9746,80 zł 9746.800000000001 PLN 9746,80 zł VAT Excluded

2065,00 € VAT Excluded

Not Available For Sale

    Ta kombinacja nie istnieje.

    Terms and Conditions
    Gwarantowany zwrot pieniędzy przez 30dni
    Wysyłka w ciągu 2-3 dni roboczych

    Purity: Greater than 90% as determined by SDS-PAGE.


    Target Name: MB


    Uniprot No.: P02192


    Species: Bos taurus (Bovine)


    Source: Yeast


    Expression Region: 2-154aa


    Target Protein Sequence:

    GLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG

    *Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


    Mol. Weight: 17.6 kDa


    Protein Length: Full Length of Mature Protein


    Tag Info: Tag-Free


    Form: Liquid or Lyophilized powder

    *Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.


    Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.


    Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.




    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.