SUPER PIGGYBAC TRANSPOSASE (PB200PA- 1) PLASMID

https://www.gentaur.be/web/image/product.template/3637/image_1920?unique=9166d12

2,270.32 zł 2270.32 PLN 2,270.32 zł

481.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Super PiggyBac Transposase (PB200PA-1)  plasmid

    PVT1602     2ug

     

    Super PiggyBac Transposase (PB200PA-1) plasmid Informaiton

    Promoter: T3, T7

    Replicator: pUC ori, F1 ori

    Terminator: SV40 poly (A) signal

    Plasmid classification: mammalian cells, transposon carriers

    Plasmid size: 8531bp

    Prokaryotic resistance: Amp

    competent cells: Stbl3

    Culture conditions: 37 centigrade, aerobic LB

    Expression host: mammalian cells

    Induction mode: no induction, instantaneous expression

    5'sequencing primers: M13R:CAGGAAACAGCTATGACC

    3'sequencing primers: primers designed according to sequence

     

    Super PiggyBac Transposase (PB200PA-1) plasmid Description

    The PiggyBac (PB) transposon is a mobile genetic element that efficiently transposes between vectors andchromosomes via a "cut and paste" mechanism. During transposition, the PB transposase recognizes transposonspecific inverted terminal repeat sequences (ITRs) located on both ends of the transposon vector and efficiently moves the contents from the original sites and efficiently integrates them into TTAA chromosomal sites. The powerful activity of the piggyBac transposon system enables genes of interest between the two ITRs in the PB vector to be easily mobilized into target genomes.The Super PiggyBac transposase expression vector features a 5’ HS4 insulator to support robust transcription from the rPolr2A promoter. The PiggyBac transposase coding sequence has been optimized for high expression, stability and activity in mammalian cells.

     

    Super PiggyBac Transposase (PB200PA-1) plasmid Sequence

    LOCUS       Exported                8531 bp ds-DNA     circular SYN 17-AUG-2018

    DEFINITION  synthetic circular DNA

    KEYWORDS    Super PiggyBac Transposase(PB200PA-1)

    SOURCE      synthetic DNA construct

      ORGANISM  synthetic DNA construct

    REFERENCE   1  (bases 1 to 8531)

      TITLE     Direct Submission

      JOURNAL   Exported Friday, August 17, 2018 from SnapGene 3.2.1

    FEATURES             Location/Qualifiers

         source          1..8531

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         intron          3442..3538

                         /note="SV40 intron"

                         /note="modified SV40 intron with splice donor and acceptor 

                         sites"

         regulatory      3608..3617

                         /regulatory_class="other"

                         /note="Kozak sequence"

                         /note="vertebrate consensus sequence for strong initiation 

                         of translation (Kozak, 1987)"

         CDS             3614..5398

                         /codon_start=1

                         /note="Super PiggyBac Transposase"

                         /translation="MGSSLDDEHILSALLQSDDELVGEDSDSEVSDHVSEDDVQSDTEE

                         AFIDEVHEVQPTSSGSEILDEQNVIEQPGSSLASNRILTLPQRTIRGKNKHCWSTSKST

                         RRSRVSALNIVRSQRGPTRMCRNIYDPLLCFKLFFTDEIISEIVKWTNAEISLKRRESM

                         TSATFRDTNEDEIYAFFGILVMTAVRKDNHMSTDDLFDRSLSMVYVSVMSRDRFDFLIR

                         CLRMDDKSIRPTLRENDVFTPVRKIWDLFIHQCIQNYTPGAHLTIDEQLLGFRGRCPFR

                         VYIPNKPSKYGIKILMMCDSGTKYMINGMPYLGRGTQTNGVPLGEYYVKELSKPVHGSC

                         RNITCDNWFTSIPLAKNLLQEPYKLTIVGTVRSNKREIPEVLKNSRSRPVGTSMFCFDG

                         PLTLVSYKPKPAKMVYLLSSCDEDASINESTGKPQMVMYYNQTKGGVDTLDQMCSVMTC

                         SRKTNRWPMALLYGMINIACINSFIIYSHNVSSKGEKVQSRKKFMRNLYMSLTSSFMRK

                         RLEAPTLKRYLRDNISNILPKEVPGTSDDSTEEPVMKKRTYCTYCPSKIRRKANASCKK

                         CKKVICREHNIDMCQSCF"

         polyA_signal    5424..5558

                         /note="SV40 poly(A) signal"

                         /note="SV40 polyadenylation signal"

         rep_origin      complement(6116..6704)

                         /direction=LEFT

                         /note="pUC ori"

                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                         replication"

         CDS             complement(6875..7735)

                         /codon_start=1

                         /gene="bla"

                         /product="beta-lactamase"

                         /note="AmpR"

                         /note="confers resistance to ampicillin, carbenicillin, and

                         related antibiotics"

                         /translation="[TEM beta-lactamase fragment, 45 aa]

                         ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                         [TEM beta-lactamase fragment, 59 aa]

                         EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                         [TEM beta-lactamase fragment, 59 aa]

                         LIKHW"

         promoter        complement(7736..7840)

                         /gene="bla"

                         /note="AmpR promoter"

         rep_origin      7867..8322

                         /direction=RIGHT

                         /note="f1 ori"

                         /note="f1 bacteriophage origin of replication; arrow 

                         indicates direction of (+) strand synthesis"

    ORIGIN

            1 gcggccgcga gctcacgggg acagcccccc cccaaagccc ccagggatgt aattacgtcc

           61 ctcccccgct agggggcagc agcgagccgc ccggggctcc gctccggtcc ggcgctcccc

          121 ccgcatcccc gagccggcag cgtgcgggga cagcccgggc acggggaagg tggcacggga

          181 tcgctttcct ctgaacgctt ctcgctgctc tttgagcctg cagacacctg gggggatacg

          241 gggaaaaagc tttaggctga aagagagatt tagaatgaca gaatcataga acggcctggg

          301 ttgcaaagga gcacagtgct catccagatc caaccccctg ctatgtgcag ggtcatcaac

          361 cagcagccca ggctgcccag agccacatcc agcctggcct tgaatgcctg cagggatggg

          421 gcatccacag cctccttggg caacctgttc agtgcgtcac caccctctgg gggaaaaact

          481 gcctcctcat atccaaccca aacctcccct gtctcagtgt aaagccattc ccccttgtcc

          541 tatcaagggg gagtttgctg tgacattgtt ggtctggggt gacacatgtt tgccaattca

          601 gtgcatcacg gagaggcaga tcttggggat aaggaagtgc aggacagcat ggacgtggga

          661 catgcaggtg ttgagggctc tgggacactc tccaagtcac agcgttcaga acagccttaa

          721 ggataagaag ataggataga aggacaaaga gcaagttaaa acccagcatg gagaggagca

          781 caaaaaggcc acagacactg ctggtccctg tgtctgagcc tgcatgtttg atggtgtctg

          841 gatgcaagca gaaggggtgg aagagcttgc ctggagagat acagctgggt cagtaggact

          901 gggacaggca gctggagaat tgccatgtag atgttcatac aatcgtcaaa tcatgaaggc

          961 tggaaaagcc ctccaagatc cccaagacca accccaaccc acccaccgtg cccactggcc

         1021 atgtccctca gtgccacatc cccacagttc ttcatcacct ccagggacgg tgaccccccc

         1081 acctccgtgg gcagctgtgc cactgcagca ccgctctttg gagaaggtaa atcttgctaa

         1141 atccagcccg accctcccct ggcacaacgt aaggccatta tctctcatcc aactccagga

         1201 cggagtcagt gagaatattg cctccctggc gagctcacgg ggacagcccc cccccaaagc

         1261 ccccagggat gtaattacgt ccctcccccg ctagggggca gcagcgagcc gcccggggct

         1321 ccgctccggt ccggcgctcc ccccgcatcc ccgagccggc agcgtgcggg gacagcccgg

         1381 gcacggggaa ggtggcacgg gatcgctttc ctctgaacgc ttctcgctgc tctttgagcc

         1441 tgcagacacc tggggggata cggggaaaaa gctttaggct gaaagagaga tttagaatga

         1501 cagaatcata gaacggcctg ggttgcaaag gagcacagtg ctcatccaga tccaaccccc

         1561 tgctatgtgc agggtcatca accagcagcc caggctgccc agagccacat ccagcctggc

         1621 cttgaatgcc tgcagggatg gggcatccac agcctccttg ggcaacctgt tcagtgcgtc

         1681 accaccctct gggggaaaaa ctgcctcctc atatccaacc caaacctccc ctgtctcagt

         1741 gtaaagccat tcccccttgt cctatcaagg gggagtttgc tgtgacattg ttggtctggg

         1801 gtgacacatg tttgccaatt cagtgcatca cggagaggca gatcttgggg ataaggaagt

         1861 gcaggacagc atggacgtgg gacatgcagg tgttgagggc tctgggacac tctccaagtc

         1921 acagcgttca gaacagcctt aaggataaga agataggata gaaggacaaa gagcaagtta

         1981 aaacccagca tggagaggag cacaaaaagg ccacagacac tgctggtccc tgtgtctgag

         2041 cctgcatgtt tgatggtgtc tggatgcaag cagaaggggt ggaagagctt gcctggagag

         2101 atacagctgg gtcagtagga ctgggacagg cagctggaga attgccatgt agatgttcat

         2161 acaatcgtca aatcatgaag gctggaaaag ccctccaaga tccccaagac caaccccaac

         2221 ccacccaccg tgcccactgg ccatgtccct cagtgccaca tccccacagt tcttcatcac

         2281 ctccagggac ggtgaccccc ccacctccgt gggcagctgt gccactgcag caccgctctt

         2341 tggagaaggt aaatcttgct aaatccagcc cgaccctccc ctggcacaac gtaaggccat

         2401 tatctctcat ccaactccag gacggagtca gtgagaatat tcggccgctc tagaactagt

         2461 ggatcccccg ggctgcagga attcgatggc cgcttgggcg ggatatctag cgccaaggtt

         2521 ccgtaaagct ctctattaga ggactggcgg tgccccatca ccctgggagg cctctccaca

         2581 aatatcggct acttccaatt gattggacgc gccatcttgt ctgcttatgc atattcagag

         2641 gatcctgaat attcatgagc gagggccgtg cggcccctcc ctccaaccct cccccggaac

         2701 aagctccgga gaacccgaca ggccccgcct tctttaccga tgcgtagaac aaaccatttt

         2761 ccgggttggg gggggaaatt aatgagagac tttagctgaa aatgagcatg gacgccaaag

         2821 ctgagtaaag atggcttaac tttatcctcc attctgtaat ccgtcagctt gagtgtacgg

         2881 gaagtcggcg aggggggcgg caggctcaga aacattctcc tcctcctgtc gcgtcagaaa

         2941 gaacacccaa ccagggagcc ggagccctgg cgtcaacatc tctggcgcgc gcgctccatg

         3001 taggccggtg cgggcggccc cgtagcgcaa gggagggcgg gaaaggaagg ggcgggacac

         3061 aagggcgaat ctataaaggg cgtcattcag ccagttctct cctcagaagc gccgagagcg

         3121 cgaccgggac ggttggagaa gaaggtggct cccggaaggg ggagagacaa actgccgtaa

         3181 cctctgccgt tcaggatccc ggccatcaag cttatcgatg ctgccgcagc aaaagcagga

         3241 gcagatgccg ccgtcgcagg cgaagatgtc gcagacggag gaggcgatgc tgccggcgga

         3301 ggaggcgaag taagtagagg gctgggctgg gctgtggggg gtgtggggtg cgggactggg

         3361 cagtctggga gtccctctca ccacttttct tacctttcta ggatgctgcc tcgaggaact

         3421 gaaaaaccag aaagttaact ggtaagttta gtctttttgt cttttatttc aggtcccgga

         3481 tccggtggtg gtgcaaatca aagaactgct cctcagtgga tgttgccttt acttctaggc

         3541 ctgtacggaa gtgttacttc tgctctaaaa gctgcggaat tgtacccaat tcgttaaggc

         3601 caaattggcc accatgggct ctagcctgga cgacgagcac atcctgagcg ccctgctgca

         3661 gagcgacgac gaactggtgg gcgaggacag cgacagcgag gtcagcgacc acgtgtccga

         3721 ggacgacgtg cagtccgaca ccgaggaagc cttcatcgac gaggtgcacg aagtgcagcc

         3781 taccagcagc ggctccgaga tcctggacga gcagaacgtg atcgagcagc ctggcagctc

         3841 cctggccagc aacagaatcc tgaccctgcc ccagagaacc atcagaggca agaacaagca

         3901 ctgctggtcc acctccaaga gcaccaggcg gagcagagtg tccgccctga acatcgtgcg

         3961 gagccagagg ggccccacca gaatgtgcag aaacatctac gaccccctgc tgtgcttcaa

         4021 gctgttcttc accgacgaga tcatcagcga gatcgtgaag tggaccaacg ccgagatcag

         4081 cctgaagagg cgggagagca tgaccagcgc caccttcaga gacaccaacg aggacgagat

         4141 ctacgccttc ttcggcatcc tggtgatgac cgccgtgaga aaggacaacc acatgagcac

         4201 cgacgacctg ttcgacagat ccctgagcat ggtgtacgtg tccgtgatga gcagagacag

         4261 attcgacttc ctgatcagat gcctgagaat ggacgacaag agcatcagac ccaccctgcg

         4321 ggagaacgac gtgttcaccc ccgtgcggaa gatctgggac ctgttcatcc accagtgcat

         4381 ccagaactac acccctggcg cccacctgac catcgatgag cagctgctgg gcttcagagg

         4441 cagatgcccc ttcagagtgt acatccccaa caagcccagc aagtacggca tcaagatcct

         4501 gatgatgtgc gacagcggca ccaagtacat gatcaacggc atgccctacc tgggcagagg

         4561 cacccagaca aacggcgtgc ccctgggcga gtactacgtg aaagaactga gcaagcctgt

         4621 gcatggcagc tgcaggaaca tcacctgcga caactggttc accagcatcc ccctggccaa

         4681 gaacctgctg caggaaccct acaagctgac catcgtgggc accgtgcgga gcaacaagcg

         4741 ggagatccca gaggtgctga agaacagcag atccagacct gtgggaacaa gcatgttctg

         4801 cttcgacggc cccctgaccc tggtgtccta caagcccaag cccgccaaga tggtgtacct

         4861 gctgtccagc tgcgacgagg acgccagcat caacgagagc accggcaagc cccagatggt

         4921 gatgtactac aaccagacca agggcggcgt ggacaccctg gaccagatgt gcagcgtgat

         4981 gacctgcagc agaaagacca acagatggcc catggccctg ctgtacggca tgatcaatat

         5041 cgcctgcatc aacagcttca tcatctacag ccacaacgtg tccagcaagg gcgagaaggt

         5101 gcagagccgg aagaaattca tgcggaacct gtacatgagc ctgacctcca gcttcatgag

         5161 aaagagactg gaagccccca ccctgaagag atacctgcgg gacaacatca gcaacatcct

         5221 gcccaaggaa gtgccaggaa caagcgacga cagcaccgag gaacccgtga tgaagaagag

         5281 gacctactgc acctactgtc ccagcaagat cagaagaaag gccaacgcca gctgcaagaa

         5341 atgcaaaaaa gtgatctgcc gggagcacaa catcgacatg tgccagagct gtttctgagg

         5401 ccgtaacggc cgccagaatt ggggatccag acatgataag atacattgat gagtttggac

         5461 aaaccacaac tagaatgcag tgaaaaaaat gctttatttg tgaaatttgt gatgctattg

         5521 ctttatttgt aaccattata agctgcaata aacaagttaa caacaacaat tgcattcatt

         5581 ttatgtttca ggttcagggg gaggtgtggg aggttttttc ggatcctcta gagtcgacct

         5641 gcaggcatgc aagctcggta cccagctttt gttcccttta gtgagggtta attgcgcgct

         5701 tggcgtaatc atggtcatag ctgtttcctg tgtgaaattg ttatccgctc acaattccac

         5761 acaacatacg agccggaagc ataaagtgta aagcctgggg tgcctaatga gtgagctaac

         5821 tcacattaat tgcgttgcgc tcactgcccg ctttccagtc gggaaacctg tcgtgccagc

         5881 tgcattaatg aatcggccaa cgcgcgggga gaggcggttt gcgtattggg cgctcttccg

         5941 cttcctcgct cactgactcg ctgcgctcgg tcgttcggct gcggcgagcg gtatcagctc

         6001 actcaaaggc ggtaatacgg ttatccacag aatcagggga taacgcagga aagaacatgt

         6061 gagcaaaagg ccagcaaaag gccaggaacc gtaaaaaggc cgcgttgctg gcgtttttcc

         6121 ataggctccg cccccctgac gagcatcaca aaaatcgacg ctcaagtcag aggtggcgaa

         6181 acccgacagg actataaaga taccaggcgt ttccccctgg aagctccctc gtgcgctctc

         6241 ctgttccgac cctgccgctt accggatacc tgtccgcctt tctcccttcg ggaagcgtgg

         6301 cgctttctca tagctcacgc tgtaggtatc tcagttcggt gtaggtcgtt cgctccaagc

         6361 tgggctgtgt gcacgaaccc cccgttcagc ccgaccgctg cgccttatcc ggtaactatc

         6421 gtcttgagtc caacccggta agacacgact tatcgccact ggcagcagcc actggtaaca

         6481 ggattagcag agcgaggtat gtaggcggtg ctacagagtt cttgaagtgg tggcctaact

         6541 acggctacac tagaaggaca gtatttggta tctgcgctct gctgaagcca gttaccttcg

         6601 gaaaaagagt tggtagctct tgatccggca aacaaaccac cgctggtagc ggtggttttt

         6661 ttgtttgcaa gcagcagatt acgcgcagaa aaaaaggatc tcaagaagat cctttgatct

         6721 tttctacggg gtctgacgct cagtggaacg aaaactcacg ttaagggatt ttggtcatga

         6781 gattatcaaa aaggatcttc acctagatcc ttttaaatta aaaatgaagt tttaaatcaa

         6841 tctaaagtat atatgagtaa acttggtctg acagttacca atgcttaatc agtgaggcac

         6901 ctatctcagc gatctgtcta tttcgttcat ccatagttgc ctgactcccc gtcgtgtaga

         6961 taactacgat acgggagggc ttaccatctg gccccagtgc tgcaatgata ccgcgagacc

         7021 cacgctcacc ggctccagat ttatcagcaa taaaccagcc agccggaagg gccgagcgca

         7081 gaagtggtcc tgcaacttta tccgcctcca tccagtctat taattgttgc cgggaagcta

         7141 gagtaagtag ttcgccagtt aatagtttgc gcaacgttgt tgccattgct acaggcatcg

         7201 tggtgtcacg ctcgtcgttt ggtatggctt cattcagctc cggttcccaa cgatcaaggc

         7261 gagttacatg atcccccatg ttgtgcaaaa aagcggttag ctccttcggt cctccgatcg

         7321 ttgtcagaag taagttggcc gcagtgttat cactcatggt tatggcagca ctgcataatt

         7381 ctcttactgt catgccatcc gtaagatgct tttctgtgac tggtgagtac tcaaccaagt

         7441 cattctgaga atagtgtatg cggcgaccga gttgctcttg cccggcgtca atacgggata

         7501 ataccgcgcc acatagcaga actttaaaag tgctcatcat tggaaaacgt tcttcggggc

         7561 gaaaactctc aaggatctta ccgctgttga gatccagttc gatgtaaccc actcgtgcac

         7621 ccaactgatc ttcagcatct tttactttca ccagcgtttc tgggtgagca aaaacaggaa

         7681 ggcaaaatgc cgcaaaaaag ggaataaggg cgacacggaa atgttgaata ctcatactct

         7741 tcctttttca atattattga agcatttatc agggttattg tctcatgagc ggatacatat

         7801 ttgaatgtat ttagaaaaat aaacaaatag gggttccgcg cacatttccc cgaaaagtgc

         7861 cacctgacgc gccctgtagc ggcgcattaa gcgcggcggg tgtggtggtt acgcgcagcg

         7921 tgaccgctac acttgccagc gccctagcgc ccgctccttt cgctttcttc ccttcctttc

         7981 tcgccacgtt cgccggcttt ccccgtcaag ctctaaatcg ggggctccct ttagggttcc

         8041 gatttagtgc tttacggcac ctcgacccca aaaaacttga ttagggtgat ggttcacgta

         8101 gtgggccatc gccctgatag acggtttttc gccctttgac gttggagtcc acgttcttta

         8161 atagtggact cttgttccaa actggaacaa cactcaaccc tatctcggtc tattcttttg

         8221 atttataagg gattttgccg atttcggcct attggttaaa aaatgagctg atttaacaaa

         8281 aatttaacgc gaattttaac aaaatattaa cgcttacaat ttccattcgc cattcaggct

         8341 gcgcaactgt tgggaagggc gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa

         8401 agggggatgt gctgcaaggc gattaagttg ggtaacgcca gggttttccc agtcacgacg

         8461 ttgtaaaacg acggccagtg agcgcgcgta atacgactca ctatagggcg aattggagct

         8521 ccaccgcggt g

    //

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.